Structural and physicochemical dissection of the anticancer peptide PNC-27: a computational reassessment of its design logic
Year: 2026
Type: preprint
Abstract: PNC-27 (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) is a chimeric peptide in which p53 residues 12–26 are fused directly to a penetratin-derived cationic module. It was designed as an intracellular MDM2/HDM-2 antagonist, but the originating laboratory has since reported that its cytotoxicity does not depend on p53 status, and has proposed a membrane-associated mechanism in its place. This work re-examines PNC-27 as a peptide-engineering problem, using structural analysis of existing crystallographic data together with sequence-level biophysics. No folding, docking or molecular dynamics was used. Per-residue burial and contact analysis across ten receptor–peptide pairs drawn from seven MDM2/MDMX structures confirms the Phe19/Trp23/Leu26 hot-spot triad and puts numbers on it. Between 34.5 and 43.7 % of the buried interface lies outside the triad even in the tightest binders. Sequence-verified numbering (p53 = position + 11) places the buried hot spot Leu26 at PNC-27 position 15, immediately before the fusion point. Extrapolation of an ideal helix shows the C-terminal fusion vector to be sterically unobstructed, with no MDM2 atom within 5 Å over eight residues, whereas an N-terminal extension clashes at 1.82 Å. The cationic module proves to be a retro sequence of penetratin, with 14 of 16 residues matching reversed Antp 43–58. It is only weakly amphipathic (µH 0.272 against 0.455 for magainin-2 through the same pipeline) and appears to act as a solubilising element for the hydrophobic p53 head rather than as a lytic helix. Both the hydrophobic-moment maximum (µH 0.713) and the most helix-favourable segment straddle the inter-module junction instead of lying within either module. A seven-member insertion series shows that any linker abolishes the amphipathic maximum, while glycine-rich and rigid helical inserts diverge in their effect on junction helix propensity. Conventional flexible-linker insertion is therefore predicted to be counterproductive. Fifteen variants across six modification strategies are described, along with the specific measurements that would most efficiently discriminate between the competing interpretations. No therapeutic claim is made; every conclusion here is a structural or physicochemical hypothesis.
Source: ChemRxiv
Author: Moisés Miguel Fernández
Language: English
Subfield: Molecular Biology
Domain: Life Sciences
Open Access status: green
OpenAlex ID: W7211882434